Мітоген-активована протеїнкіназа 1

Мітоген-активована протеїнкіназа 1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1PME, 1TVO, 1WZY, 2OJG, 2OJI, 2OJJ, 2Y9Q, 3D42, 3D44, 3I5Z, 3I60, 3SA0, 3TEI, 3W55, 4FMQ, 4FUX, 4FUY, 4FV0, 4FV1, 4FV2, 4FV3, 4FV4, 4FV5, 4FV6, 4FV7, 4FV8, 4FV9, 4G6N, 4G6O, 4H3P, 4H3Q, 4IZ5, 4IZ7, 4IZA, 4N0S, 4NIF, 4O6E, 4QTA, 4QTE, 4ZZM, 4ZZN, 4ZZO, 5BUE, 5BUI, 5BUJ, 4QP1, 4QP2, 4QP3, 4QP4, 4QP6, 4QP7, 4QP8, 4QP9, 4QPA, 4XJ0, 5BVD, 5BVE, 5BVF, 5AX3, 4ZXT, 5K4I

Ідентифікатори
Символи MAPK1, ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK, mitogen-activated protein kinase 1, NS13
Зовнішні ІД OMIM: 176948 MGI: 1346858 HomoloGene: 37670 GeneCards: MAPK1
Пов'язані генетичні захворювання
розсіяний склероз[1]
Реагує на сполуку
ravoxertinib, ulixertinib[2]
Онтологія гена
Молекулярна функція

phosphatase binding
ATP binding
protein kinase activity
transcription factor binding
transferase activity
mitogen-activated protein kinase kinase kinase binding
phosphotyrosine residue binding
GO:0001948, GO:0016582 protein binding
protein kinase binding
DNA binding
nucleotide binding
RNA polymerase II CTD heptapeptide repeat kinase activity
protein serine/threonine kinase activity
kinase activity
identical protein binding
MAP kinase activity
double-stranded DNA binding
MAP kinase kinase activity

Клітинна компонента

цитоплазма
гіалоплазма
focal adhesion
центр організації мікротрубочок
мітохондрія
caveola
dendrite cytoplasm
цитоскелет
клітинне ядро
екзосома
перикаріон
late endosome
комплекс Ґольджі
веретено поділу
аксон
early endosome
mitotic spindle
Псевдоподія
extracellular region
нуклеоплазма
azurophil granule lumen
ficolin-1-rich granule lumen
клітинна мембрана
GO:0097483, GO:0097481 постсинаптичне ущільнення
мембрана
GO:0009327 protein-containing complex

Біологічний процес

caveolin-mediated endocytosis
positive regulation of telomere capping
response to exogenous dsRNA
cardiac neural crest cell development involved in heart development
positive regulation of translation
cellular response to DNA damage stimulus
platelet activation
Fc-epsilon receptor signaling pathway
protein phosphorylation
face development
cellular response to granulocyte macrophage colony-stimulating factor stimulus
regulation of DNA-binding transcription factor activity
animal organ morphogenesis
клітинний цикл
ERBB signaling pathway
GO:0097285 апоптоз
B cell receptor signaling pathway
GO:0009373 regulation of transcription, DNA-templated
regulation of protein stability
Fc-gamma receptor signaling pathway involved in phagocytosis
thymus development
negative regulation of cell differentiation
ERK1 and ERK2 cascade
labyrinthine layer blood vessel development
transcription, DNA-templated
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
heart development
GO:0022415 viral process
response to toxic substance
regulation of stress-activated MAPK cascade
chemical synaptic transmission
growth hormone receptor signaling pathway via JAK-STAT
cytosine metabolic process
фосфорилювання
outer ear morphogenesis
response to estrogen
хемотаксис
response to lipopolysaccharide
thyroid gland development
response to epidermal growth factor
positive regulation of telomerase activity
sensory perception of pain
peptidyl-threonine phosphorylation
trachea formation
lipopolysaccharide-mediated signaling pathway
mammary gland epithelial cell proliferation
GO:0007243 intracellular signal transduction
lung morphogenesis
neural crest cell development
positive regulation of cell migration
regulation of early endosome to late endosome transport
response to stress
positive regulation of telomere maintenance via telomerase
MAPK cascade
axon guidance
fibroblast growth factor receptor signaling pathway
positive regulation of peptidyl-threonine phosphorylation
GO:0035404 peptidyl-serine phosphorylation
positive regulation of cell population proliferation
regulation of cellular response to heat
Bergmann glial cell differentiation
regulation of Golgi inheritance
T cell receptor signaling pathway
regulation of cytoskeleton organization
GO:0072468 сигнальна трансдукція
довготривала потенціація
regulation of ossification
regulation of phosphatidylinositol 3-kinase signaling
neutrophil degranulation
регуляція експресії генів
cellular response to organic substance
GO:0010260 старіння людини
learning or memory
GO:1901313 positive regulation of gene expression
diadenosine tetraphosphate biosynthetic process
regulation of cellular pH
cellular response to amino acid starvation
GO:0072353 cellular response to reactive oxygen species
response to nicotine
decidualization
stress-activated MAPK cascade
positive regulation of cardiac muscle cell proliferation
cellular response to cadmium ion
cellular response to tumor necrosis factor
cellular response to dopamine
positive regulation of protein import into nucleus

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
5594
26413
Ensembl
ENSG00000100030
ENSMUSG00000063358
UniProt
P28482
P63085
RefSeq (мРНК)
NM_138957
NM_002745
NM_001038663
NM_011949
NM_001357115
NM_028991
RefSeq (білок)
NP_002736
NP_620407
NP_001033752
NP_036079
NP_001344044
Локус (UCSC) Хр. 22: 21.76 – 21.87 Mb Хр. 16: 16.8 – 16.87 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Мітоген-активована протеїнкіназа 1 (англ. Mitogen-activated protein kinase 1) – білок, який кодується геном MAPK1, розташованим у людей на короткому плечі 22-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 360 амінокислот, а молекулярна маса — 41 390[6].

Послідовність амінокислот
1020304050
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVR
VAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKD
VYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDL
KPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIML
NSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQE
DLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEE
TARFQPGYRS

Цей білок за функціями належить до трансфераз, репресорів, кіназ, серин/треонінових протеїнкіназ. Задіяний у таких біологічних процесах як апоптоз, взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, клітинний цикл. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література

  • Owaki H., Makar R., Boulton T.G., Cobb M.H., Geppert T.D. (1992). Extracellular signal-regulated kinases in T cells: characterization of human ERK1 and ERK2 cDNAs. Biochem. Biophys. Res. Commun. 182: 1416—1422. PMID 1540184 DOI:10.1016/0006-291X(92)91891-S
  • Gonzalez F.A., Raden D.L., Rigby M.R., Davis R.J. (1992). Heterogeneous expression of four MAP kinase isoforms in human tissues. FEBS Lett. 304: 170—178. PMID 1319925 DOI:10.1016/0014-5793(92)80612-K
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Ni H., Wang X.S., Diener K., Yao Z. (1998). MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase. Biochem. Biophys. Res. Commun. 243: 492—496. PMID 9480836 DOI:10.1006/bbrc.1998.8135
  • Deak M., Clifton A.D., Lucocq J.M., Alessi D.R. (1998). Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB. EMBO J. 17: 4426—4441. PMID 9687510 DOI:10.1093/emboj/17.15.4426
  • Niu H., Ye B.H., Dalla-Favera R. (1998). Antigen receptor signaling induces MAP kinase-mediated phosphorylation and degradation of the BCL-6 transcription factor. Genes Dev. 12: 1953—1961. PMID 9649500 DOI:10.1101/gad.12.13.1953

Примітки

  1. Захворювання, генетично пов'язані з Мітоген-активована протеїнкіназа 1 переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з mitogen-activated protein kinase 1 переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. HUGO Gene Nomenclature Commitee, HGNC:6871 (англ.) . Архів оригіналу за 18 квітня 2017. Процитовано 27 лютого 2017.
  6. UniProt, P28482 (англ.) . Архів оригіналу за 6 лютого 2017. Процитовано 27 лютого 2017.

Див. також

  • Хромосома 22
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»