BAX

BAX
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

4BDU, 1F16, 2G5B, 2K7W, 2LR1, 3PK1, 3PL7, 4BD2, 4BD6, 4BD7, 4BD8, 4UF2, 4ZIE, 4ZIF, 4ZIG, 4ZIH, 4ZII, 4S0O

Ідентифікатори
Символи BAX, BCL2L4, BCL2 associated X protein, BCL2 associated X, apoptosis regulator
Зовнішні ІД OMIM: 600040 MGI: 99702 HomoloGene: 7242 GeneCards: BAX
Онтологія гена
Молекулярна функція

protein homodimerization activity
channel activity
GO:0001948, GO:0016582 protein binding
BH3 domain binding
chaperone binding
protein heterodimerization activity
identical protein binding
lipid binding
Hsp70 protein binding

Клітинна компонента

гіалоплазма
nuclear envelope
мембрана
Bcl-2 family protein complex
мітохондрія
клітинне ядро
mitochondrial permeability transition pore complex
мітохондріальна мембрана
BAX complex
ендоплазматичний ретикулум
екзосома
pore complex
integral component of membrane
внутрішньоклітинний
endoplasmic reticulum membrane
цитоплазма
мітохондріальна зовнішня мембрана
cell periphery

Біологічний процес

GO:1904089 negative regulation of neuron apoptotic process
response to ionizing radiation
germ cell development
positive regulation of calcium ion transport into cytosol
glycosphingolipid metabolic process
B cell apoptotic process
response to salt stress
Sertoli cell proliferation
thymocyte apoptotic process
T cell homeostatic proliferation
post-embryonic development
regulation of mitochondrial membrane permeability involved in apoptotic process
negative regulation of protein binding
cellular response to DNA damage stimulus
regulation of mitochondrial membrane permeability involved in programmed necrotic cell death
odontogenesis of dentin-containing tooth
positive regulation of extrinsic apoptotic signaling pathway in absence of ligand
positive regulation of IRE1-mediated unfolded protein response
blood vessel remodeling
positive regulation of neuron apoptotic process
apoptotic process involved in blood vessel morphogenesis
activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
Сперматогенез
apoptotic signaling pathway
проліферація
mitochondrion morphogenesis
activation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of cell population proliferation
cellular response to organic substance
B cell homeostatic proliferation
limb morphogenesis
release of matrix enzymes from mitochondria
extrinsic apoptotic signaling pathway
розвиток нирки
activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
negative regulation of apoptotic signaling pathway
myeloid cell homeostasis
regulation of neuron apoptotic process
regulation of cysteine-type endopeptidase activity involved in apoptotic process
endoplasmic reticulum calcium ion homeostasis
response to wounding
intrinsic apoptotic signaling pathway by p53 class mediator
hypothalamus development
GO:0022415 viral process
protein homooligomerization
response to gamma radiation
negative regulation of fibroblast proliferation
positive regulation of intrinsic apoptotic signaling pathway
response to toxic substance
B cell negative selection
GO:1990613 mitochondrial fusion
neuron apoptotic process
male gonad development
positive regulation of B cell apoptotic process
regulation of protein heterodimerization activity
positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
cellular response to UV
sex differentiation
neuron migration
B cell homeostasis
positive regulation of release of sequestered calcium ion into cytosol
positive regulation of apoptotic process involved in mammary gland involution
нейробіологія розвитку
spermatid differentiation
development of secondary sexual characteristics
positive regulation of developmental pigmentation
retina development in camera-type eye
response to axon injury
positive regulation of mitochondrial membrane permeability involved in apoptotic process
cerebral cortex development
ovarian follicle development
запліднення
ectopic germ cell programmed cell death
homeostasis of number of cells within a tissue
positive regulation of release of cytochrome c from mitochondria
B cell receptor apoptotic signaling pathway
negative regulation of endoplasmic reticulum calcium ion concentration
regulation of protein homodimerization activity
apoptotic process involved in embryonic digit morphogenesis
leukocyte homeostasis
positive regulation of apoptotic DNA fragmentation
mitochondrial fragmentation involved in apoptotic process
positive regulation of endoplasmic reticulum unfolded protein response
establishment or maintenance of transmembrane electrochemical gradient
homeostasis of number of cells
vagina development
post-embryonic camera-type eye morphogenesis
regulation of mammary gland epithelial cell proliferation
retinal cell programmed cell death
regulation of cell cycle
regulation of mitochondrial membrane potential
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
apoptotic mitochondrial changes
protein complex oligomerization
regulation of nitrogen utilization
negative regulation of peptidyl-serine phosphorylation
positive regulation of apoptotic process
positive regulation of protein oligomerization
extrinsic apoptotic signaling pathway via death domain receptors
release of cytochrome c from mitochondria
GO:0097285 апоптоз
protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
intrinsic apoptotic signaling pathway
regulation of apoptotic process
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
intrinsic apoptotic signaling pathway in response to DNA damage
extrinsic apoptotic signaling pathway in absence of ligand
transcription initiation from RNA polymerase II promoter
Unfolded Protein Response
negative regulation of mitochondrial membrane potential

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
581
12028
Ensembl
ENSG00000087088
ENSMUSG00000003873
UniProt
Q07812
Q5ZPJ0
Q07813
RefSeq (мРНК)
NM_001291428
NM_001291429
NM_001291430
NM_001291431
NM_004324
NM_138761
NM_138762
NM_138763
NM_138764
NM_007527
RefSeq (білок)
NP_001278357
NP_001278358
NP_001278359
NP_001278360
NP_004315
NP_620116
NP_620118
NP_620119
NP_001278358.1
NP_031553
Локус (UCSC) Хр. 19: 48.95 – 48.96 Mb Хр. 7: 45.11 – 45.12 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BAX (англ. BCL2 associated X, apoptosis regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 192 амінокислот, а молекулярна маса — 21 184[4].

Послідовність амінокислот
1020304050
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Задіяний у таких біологічних процесах, як апоптоз, взаємодія хазяїн-вірус, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, мембрані, мітохондрії.

Література

  • Oltvai Z.N., Milliman C.L., Korsmeyer S.J. (1993). Bcl-2 heterodimerizes in vivo with a conserved homolog, Bax, that accelerates programmed cell death. Cell. 74: 609—619. PMID 8358790 DOI:10.1016/0092-8674(93)90509-O
  • Apte S.S., Mattei M.-G., Olsen B.R. (1995). Mapping of the human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX delta. Genomics. 26: 592—594. PMID 7607685 DOI:10.1016/0888-7543(95)80180-T
  • Schmitt E., Paquet C., Beauchemin M., Dever-Bertrand J., Bertrand R. (2000). Characterization of Bax-sigma, a cell death-inducing isoform of Bax. Biochem. Biophys. Res. Commun. 270: 868—879. PMID 10772918 DOI:10.1006/bbrc.2000.2537
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Nechushtan A., Smith C.L., Hsu Y.-T., Youle R.J. (1999). Conformation of the Bax C-terminus regulates subcellular location and cell death. EMBO J. 18: 2330—2341. PMID 10228148 DOI:10.1093/emboj/18.9.2330
  • Gustafsson A.B., Tsai J.G., Logue S.E., Crow M.T., Gottlieb R.A. (2004). Apoptosis repressor with caspase recruitment domain protects against cell death by interfering with Bax activation. J. Biol. Chem. 279: 21233—21238. PMID 15004034 DOI:10.1074/jbc.M400695200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:959 (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 12 вересня 2017.
  4. UniProt, Q07812 (англ.) . Архів оригіналу за 18 серпня 2017. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 19
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»