CCL21

CCL21
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

2L4N

Ідентифікатори
Символи CCL21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4, C-C motif chemokine ligand 21
Зовнішні ІД OMIM: 602737 MGI: 1349183 HomoloGene: 2247 GeneCards: CCL21
Онтологія гена
Молекулярна функція

cytokine activity
chemokine receptor binding
CCR7 chemokine receptor binding
chemokine activity
CCR chemokine receptor binding
GO:0001948, GO:0016582 protein binding

Клітинна компонента

extracellular region
міжклітинний простір

Біологічний процес

negative regulation of leukocyte tethering or rolling
release of sequestered calcium ion into cytosol
positive regulation of receptor-mediated endocytosis
positive regulation of protein kinase B signaling
positive regulation of cell motility
positive regulation of actin filament polymerization
monocyte chemotaxis
GO:0032861, GO:0032862, GO:0032856 activation of GTPase activity
ruffle organization
positive regulation of cell-matrix adhesion
chemokine-mediated signaling pathway
cellular response to tumor necrosis factor
cell-cell signaling
T cell costimulation
cell maturation
positive regulation of JNK cascade
dendritic cell chemotaxis
negative regulation of dendritic cell dendrite assembly
positive regulation of phosphatidylinositol 3-kinase activity
хемотаксис
response to prostaglandin E
positive regulation of dendritic cell antigen processing and presentation
dendritic cell dendrite assembly
positive regulation of pseudopodium assembly
mesangial cell-matrix adhesion
positive regulation of chemotaxis
cellular response to interleukin-1
GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
establishment of T cell polarity
positive regulation of ERK1 and ERK2 cascade
positive regulation of glycoprotein biosynthetic process
cellular response to interferon-gamma
positive regulation of I-kappaB kinase/NF-kappaB signaling
cell chemotaxis
lymphocyte chemotaxis
positive regulation of neutrophil chemotaxis
positive regulation of cell adhesion mediated by integrin
immunological synapse formation
positive regulation of filopodium assembly
positive regulation of T cell migration
positive regulation of myeloid dendritic cell chemotaxis
positive regulation of protein kinase activity
inflammatory response
antimicrobial humoral immune response mediated by antimicrobial peptide
regulation of signaling receptor activity
G protein-coupled receptor signaling pathway
negative regulation of dendritic cell apoptotic process
positive regulation of T cell chemotaxis
neutrophil chemotaxis
chemokine (C-C motif) ligand 21 signaling pathway
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
cellular response to chemokine

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
6366
18829
Ensembl
ENSG00000137077
ENSMUSG00000094686
UniProt
O00585
P84444
RefSeq (мРНК)
NM_002989
NM_011124
RefSeq (білок)
NP_002980
NP_035254
Локус (UCSC) Хр. 9: 34.71 – 34.71 Mb Хр. 4: 42.77 – 42.77 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CCL21 (англ. C-C motif chemokine ligand 21) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 134 амінокислот, а молекулярна маса — 14 646[4].

Послідовність амінокислот
1020304050
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRK
QEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA
QGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як запальна відповідь, хемотаксис. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hedrick J.A., Zlotnik A. (1997). Identification and characterization of a novel beta chemokine containing six conserved cysteines. J. Immunol. 159: 1589—1593. PMID 9257816

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:10620 (англ.) . Архів оригіналу за 3 березня 2016. Процитовано 8 вересня 2017.
  4. UniProt, O00585 (англ.) . Архів оригіналу за 22 серпня 2017. Процитовано 8 вересня 2017.

Див. також

  • Хромосома 9
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.