HAVCR2

HAVCR2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

5F71

Ідентифікатори
Символи HAVCR2, HAVcr-2, KIM-3, TIM3, TIMD-3, TIMD3, Tim-3, CD366, hepatitis A virus cellular receptor 2, SPTCL
Зовнішні ІД OMIM: 606652 MGI: 2159682 HomoloGene: 129541 GeneCards: HAVCR2
Онтологія гена
Молекулярна функція

зв'язування з іоном металу
GO:0001948, GO:0016582 protein binding

Клітинна компонента

integral component of membrane
мембрана
міжклітинні контакти
early endosome
immunological synapse
cell surface
mediator complex

Біологічний процес

negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
negative regulation of defense response to bacterium
negative regulation of interferon-gamma production
negative regulation of immunological synapse formation
адаптивна імунна відповідь
maternal process involved in female pregnancy
GO:0032737 positive regulation of cytokine production
negative regulation of natural killer cell activation
процес імунної системи
negative regulation of immune response to tumor cell
negative regulation of interleukin-6 production
negative regulation of granulocyte colony-stimulating factor production
natural killer cell tolerance induction
positive regulation of interferon-gamma production
positive regulation of macrophage activation
regulation of tolerance induction dependent upon immune response
negative regulation of T-helper 1 type immune response
positive regulation of defense response to bacterium
positive regulation of interleukin-4 production
negative regulation of gene expression
positive regulation of NIK/NF-kappaB signaling
negative regulation of myeloid dendritic cell activation
macrophage activation involved in immune response
negative regulation of T cell proliferation
positive regulation of T cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of innate immune response
negative regulation of interferon-alpha production
negative regulation of innate immune response
positive regulation of chemokine production
negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
negative regulation of tumor necrosis factor production
toll-like receptor 9 signaling pathway
negative regulation of type I interferon production
вроджений імунітет
inflammatory response
negative regulation of interleukin-3 production
negative regulation of NF-kappaB transcription factor activity
toll-like receptor 3 signaling pathway
negative regulation of interleukin-2 production
cellular response to lipopolysaccharide
positive regulation of interleukin-1 production
toll-like receptor 7 signaling pathway
GO:0051637 defense response to Gram-positive bacterium
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
84868
171285
Ensembl
ENSG00000135077
ENSMUSG00000020399
UniProt
Q8TDQ0
Q8VIM0
RefSeq (мРНК)
NM_032782
NM_134250
RefSeq (білок)
NP_116171
NP_599011
Локус (UCSC) Хр. 5: 157.09 – 157.14 Mb Хр. 11: 46.35 – 46.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HAVCR2 (англ. Hepatitis A virus cellular receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 301 амінокислот, а молекулярна маса — 33 394[4].

Послідовність амінокислот
1020304050
MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP
VCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENV
TLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQRDFTAAFPR
MLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIR
IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL
ANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM
P

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як адаптивний імунітет, імунітет, вроджений імунітет, запальна відповідь, альтернативний сплайсинг, поліморфізм. Білок має сайт для зв'язування з іонами металів. Локалізований у мембрані, клітинних контактах.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. (2011). Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD. Mol. Cell. Proteomics: —. PMID 22171320 DOI:10.1074/mcp.M111.013649
  • Gautron A.S., Dominguez-Villar M., de Marcken M., Hafler D.A. (2014). Enhanced suppressor function of TIM-3+ FoxP3+ regulatory T cells. Eur. J. Immunol. 44: 2703—2711. PMID 24838857 DOI:10.1002/eji.201344392
  • Gorman J.V., Colgan J.D. (2014). Regulation of T cell responses by the receptor molecule Tim-3. Immunol. Res. 59: 56—65. PMID 24825777 DOI:10.1007/s12026-014-8524-1

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:18437 (англ.) . Процитовано 5 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q8TDQ0 (англ.) . Архів оригіналу за 26 вересня 2017. Процитовано 5 вересня 2017.

Див. також

  • Хромосома 5
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.