IL23A

IL23A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

3D85, 3D87, 3DUH, 3QWR, 4GRW, 4OE8, 4OG9

Ідентифікатори
Символи IL23A, IL-23, IL-23A, IL23P19, P19, SGRF, Interleukin 23, interleukin 23 subunit alpha
Зовнішні ІД OMIM: 605580 MGI: 1932410 HomoloGene: 12832 GeneCards: IL23A
Реагує на сполуку
tildrakizumab[1]
Онтологія гена
Молекулярна функція

cytokine activity
interleukin-23 receptor binding
GO:0001948, GO:0016582 protein binding

Клітинна компонента

interleukin-23 complex
extracellular region
міжклітинний простір
endoplasmic reticulum lumen

Біологічний процес

negative regulation of interleukin-10 production
positive regulation of inflammatory response
positive regulation of interleukin-12 production
positive regulation of interleukin-10 production
процес імунної системи
positive regulation of T cell mediated cytotoxicity
positive regulation of interferon-gamma production
positive regulation of natural killer cell activation
positive regulation of osteoclast differentiation
positive regulation of T-helper 17 cell lineage commitment
positive regulation of NK T cell activation
T cell proliferation
positive regulation of natural killer cell proliferation
positive regulation of NK T cell proliferation
positive regulation of T-helper 17 type immune response
defense response to virus
positive regulation of tissue remodeling
positive regulation of T-helper 1 type immune response
positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0051636 defense response to Gram-negative bacterium
positive regulation of T cell proliferation
GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
positive regulation of memory T cell differentiation
positive regulation of neutrophil chemotaxis
positive regulation of tumor necrosis factor production
positive regulation of interleukin-17 production
вроджений імунітет
inflammatory response
tissue remodeling
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
positive regulation of activated T cell proliferation
positive regulation of defense response to virus by host
positive regulation of activation of Janus kinase activity
regulation of tyrosine phosphorylation of STAT protein
positive regulation of tyrosine phosphorylation of STAT protein
regulation of signaling receptor activity
cytokine-mediated signaling pathway
interleukin-23-mediated signaling pathway
positive regulation of NIK/NF-kappaB signaling

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
51561
83430
Ensembl
ENSG00000110944
ENSMUSG00000025383
UniProt
Q9NPF7
Q9EQ14
RefSeq (мРНК)
NM_016584
NM_031252
RefSeq (білок)
NP_057668
NP_112542
Локус (UCSC) Хр. 12: 56.33 – 56.34 Mb Хр. 10: 128.13 – 128.13 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL23A (англ. Interleukin 23 subunit alpha) – білок, який кодується однойменним геном, розташованим у людей на 12-й хромосомі.[4] Довжина поліпептидного ланцюга білка становить 189 амінокислот, а молекулярна маса — 20 730[5].

Послідовність амінокислот
1020304050
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPL
VGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFY
EKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSL
SPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, запальна відповідь, ремоделювання тканини, противірусний захист. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Pirhonen J., Matikainen S., Julkunen I. (2002). Regulation of virus-induced IL-12 and IL-23 expression in human macrophages. J. Immunol. 169: 5673—5678. PMID 12421946 DOI:10.4049/jimmunol.169.10.5673
  • Vanden Eijnden S., Goriely S., De Wit D., Goldman M., Willems F. (2006). Preferential production of the IL-12(p40)/IL-23(p19) heterodimer by dendritic cells from human newborns. Eur. J. Immunol. 36: 21—26. PMID 16342235 DOI:10.1002/eji.200535467
  • Piskin G., Sylva-Steenland R.M.R., Bos J.D., Teunissen M.B.M. (2006). In vitro and in situ expression of IL-23 by keratinocytes in healthy skin and psoriasis lesions: enhanced expression in psoriatic skin. J. Immunol. 176: 1908—1915. PMID 16424222 DOI:10.4049/jimmunol.176.3.1908
  • Vaknin-Dembinsky A., Balashov K., Weiner H.L. (2006). IL-23 is increased in dendritic cells in multiple sclerosis and down-regulation of IL-23 by antisense oligos increases dendritic cell IL-10 production. J. Immunol. 176: 7768—7774. PMID 16751425 DOI:10.4049/jimmunol.176.12.7768
  • Lupardus P.J., Garcia K.C. (2008). The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12. J. Mol. Biol. 382: 931—941. PMID 18680750 DOI:10.1016/j.jmb.2008.07.051

Примітки

  1. Сполуки, які фізично взаємодіють з IL23A переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:15488 (англ.) . Процитовано 19 вересня 2017.
  5. UniProt, Q9NPF7 (англ.) . Архів оригіналу за 2 жовтня 2017. Процитовано 19 вересня 2017.

Див. також

  • Хромосома 12
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»